M-CSF (CSF1) (NM_172211) Human Mass Spec Standard
CAT#: PH317172
CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217172 |
Predicted MW | 29 kDa |
Protein Sequence |
>RC217172 representing NM_172211
Red=Cloning site Green=Tags(s) MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGSSSPQLQESVFHLLVPSVILV LLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_757350 |
RefSeq Size | 1855 |
RefSeq ORF | 768 |
Synonyms | CSF-1; MCSF |
Locus ID | 1435 |
UniProt ID | P09603 |
Cytogenetics | 1p13.3 |
Summary | 'The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC406741 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC406742 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430359 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 |
USD 605.00 |
|
LY406741 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 |
USD 396.00 |
|
LY406742 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
USD 396.00 |
|
LY424534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
USD 396.00 |
|
LY430359 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
USD 396.00 |
|
PH305855 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757351) |
USD 2,055.00 |
|
PH313103 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757349) |
USD 2,055.00 |
|
PH317104 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748) |
USD 2,055.00 |
|
TP305855 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
USD 867.00 |
|
TP313103 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 |
USD 823.00 |
|
TP317104 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
USD 748.00 |
|
TP317172 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 |
USD 748.00 |
|
TP720352 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
USD 330.00 |
|
TP723288 | Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4. |
USD 240.00 |
|
TP723739 | Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
USD 170.00 |
{0} Product Review(s)
Be the first one to submit a review