Transmembrane protein 30A (TMEM30A) (NM_018247) Human Mass Spec Standard

CAT#: PH317257

TMEM30A MS Standard C13 and N15-labeled recombinant protein (NP_060717)

Product Images

Coomassie blue staining of purified TMEM30A protein (Cat# TP317257). The protein was produced from HEK293T cells transfected with TMEM30A cDNA clone (Cat# RC217257) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217257
• Predicted MW: 40.5 kDa
• Protein Sequence:
  Sequence Link

  >RC217257 representing NM_018247
  Red=Cloning site Green=Tags(s)
  
  MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFV
  TSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDD
  SQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDK
  NVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKS
  DLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKY
  RNSSNTADITI
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060717
• RefSeq Size: 4410
• RefSeq ORF: 1083
• Synonyms: C6orf67; CDC50A
• Locus ID: 55754
• UniProt ID: Q9NV96
• Cytogenetics: 6q14.1
• Protein Families: Druggable Genome, Transmembrane