TICAM2 (NM_021649) Human Mass Spec Standard

CAT#: PH317645

TICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_067681)

Product Images

Coomassie blue staining of purified TICAM2 protein (Cat# TP317645). The protein was produced from HEK293T cells transfected with TICAM2 cDNA clone (Cat# RC217645) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217645
• Predicted MW: 26.7 kDa
• Protein Sequence:
  Sequence Link

  >RC217645 representing NM_021649
  Red=Cloning site Green=Tags(s)
  
  MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFE
  EEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLT
  ENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIF
  QESVYKTQQTIWKETRNMVQRQFIA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067681
• RefSeq Size: 3453
• RefSeq ORF: 705
• Synonyms: MyD88-4; TICAM-2; TIRAP3; TIRP; TRAM
• Locus ID: 353376
• UniProt ID: Q86XR7
• Cytogenetics: 5q22.3
• Summary: TIRP is a Toll/interleukin-1 receptor (IL1R; MIM 147810) (TIR) domain-containing adaptor protein involved in Toll receptor signaling (see TLR4; MIM 603030). [supplied by OMIM, Apr 2004]
• Protein Families: Druggable Genome
• Protein Pathways: Toll-like receptor signaling pathway