Cyclin Y (CCNY) (NM_145012) Human Mass Spec Standard

CAT#: PH317807

CCNY MS Standard C13 and N15-labeled recombinant protein (NP_659449)

Product Images

Coomassie blue staining of purified CCNY protein (Cat# TP317807). The protein was produced from HEK293T cells transfected with CCNY cDNA clone (Cat# RC217807) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217807
• Predicted MW: 39.2 kDa
• Protein Sequence:
  Sequence Link

  >RC217807 representing NM_145012
  Red=Cloning site Green=Tags(s)
  
  MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL
  SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM
  LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA
  NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS
  LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_659449
• RefSeq Size: 2135
• RefSeq ORF: 1023
• Synonyms: C10orf9; CBCP1; CCNX; CFP1
• Locus ID: 219771
• UniProt ID: Q8ND76
• Cytogenetics: 10p11.21
• Summary: Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]). [supplied by OMIM, May 2009]