Cyclin Y (CCNY) (NM_181698) Human Mass Spec Standard
CAT#: PH320991
CCNY MS Standard C13 and N15-labeled recombinant protein (NP_859049)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220991 |
Predicted MW | 39.3 kDa |
Protein Sequence |
>RC220991 representing NM_181698
Red=Cloning site Green=Tags(s) MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_859049 |
RefSeq Size | 4735 |
RefSeq ORF | 1026 |
Synonyms | C10orf9; CBCP1; CCNX; CFP1 |
Locus ID | 219771 |
UniProt ID | Q8ND76 |
Cytogenetics | 10p11.21 |
Summary | Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]). [supplied by OMIM, May 2009] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408148 | CCNY HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430126 | CCNY HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408148 | Transient overexpression lysate of cyclin Y (CCNY), transcript variant 1 |
USD 396.00 |
|
LY430126 | Transient overexpression lysate of cyclin Y (CCNY), transcript variant 1 |
USD 396.00 |
|
PH317807 | CCNY MS Standard C13 and N15-labeled recombinant protein (NP_659449) |
USD 2,055.00 |
|
TP317807 | Purified recombinant protein of Homo sapiens cyclin Y (CCNY), transcript variant 1 |
USD 748.00 |
|
TP320991 | Recombinant protein of human cyclin Y (CCNY), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review