HNF 4 alpha (HNF4A) (NM_178850) Human Mass Spec Standard
CAT#: PH317924
HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849181)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217924 |
| Predicted MW | 46.4 kDa |
| Protein Sequence |
>RC217924 representing NM_178850
Red=Cloning site Green=Tags(s) MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ MIEQIQFIKLFGMAKIDNLLQEMLLGGPCQAQEGRGWSGDSPGDRPHTVSSPLSSLASPLCRFGQVA myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_849181 |
| RefSeq Size | 1600 |
| RefSeq ORF | 1251 |
| Synonyms | FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF14 |
| Locus ID | 3172 |
| UniProt ID | P41235 |
| Cytogenetics | 20q13.12 |
| Summary | 'The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012]' |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors |
| Protein Pathways | Maturity onset diabetes of the young |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400161 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC405861 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422283 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422284 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425507 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400161 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 |
USD 665.00 |
|
| LY405861 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 |
USD 665.00 |
|
| LY422283 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
USD 665.00 |
|
| LY422284 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 |
USD 436.00 |
|
| LY425507 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
USD 396.00 |
|
| PH311443 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174) |
USD 2,055.00 |
|
| PH314914 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849180) |
USD 2,055.00 |
|
| PH316588 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025175) |
USD 2,055.00 |
|
| PH317863 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_000448) |
USD 2,055.00 |
|
| TP311443 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
USD 788.00 |
|
| TP314914 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 1 |
USD 748.00 |
|
| TP316588 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 |
USD 823.00 |
|
| TP317863 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 |
USD 748.00 |
|
| TP317924 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China