HNF 4 alpha (HNF4A) (NM_178850) Human Recombinant Protein
CAT#: TP317924
Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217924 representing NM_178850
Red=Cloning site Green=Tags(s) MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ MIEQIQFIKLFGMAKIDNLLQEMLLGGPCQAQEGRGWSGDSPGDRPHTVSSPLSSLASPLCRFGQVA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | HNF4A Activity Verified in a DNA-binding Assay: HNF4A (TP317924, transcript variant 3) activity was measured in a colorimetric DNA-binding assay. Purified HNF4A protein containing a C-terminal MYC/DDK tag was incubated with biotinylated double-stranded oligonucleotide containing the HNF4A consensus DNA-binding sequence (see below). Following incubation, the reaction was transferred to a streptavidin-coated microplate to allow capture of the DNA-protein complex. After washing, the captured protein was detected with an anti-DDK peroxidase conjugate and colorimetric signal detection with TMB. Specificity of the protein-DNA interaction was confirmed by carrying out the binding in the presence of an unlabeled competitor oligonucleotide and by comparison to binding to an oligonucleotide containing a mutation in the consensus binding sequence. |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_849181 |
Locus ID | 3172 |
UniProt ID | P41235 |
Cytogenetics | 20q13.12 |
Refseq Size | 1600 |
Refseq ORF | 1251 |
Synonyms | FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF-14; TCF14 |
Summary | The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400161 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC405861 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422283 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422284 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425507 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400161 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 |
USD 605.00 |
|
LY405861 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 |
USD 605.00 |
|
LY422283 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
USD 605.00 |
|
LY422284 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 |
USD 396.00 |
|
LY425507 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
USD 396.00 |
|
PH311443 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174) |
USD 2,055.00 |
|
PH314914 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849180) |
USD 2,055.00 |
|
PH316588 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025175) |
USD 2,055.00 |
|
PH317863 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_000448) |
USD 2,055.00 |
|
PH317924 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849181) |
USD 2,055.00 |
|
TP311443 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
USD 788.00 |
|
TP314914 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 1 |
USD 748.00 |
|
TP316588 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 |
USD 823.00 |
|
TP317863 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review