CD200 (NM_001004196) Human Mass Spec Standard

CAT#: PH317941

CD200 MS Standard C13 and N15-labeled recombinant protein (NP_001004196)

Product Images

Coomassie blue staining of purified CD200 protein (Cat# TP317941). The protein was produced from HEK293T cells transfected with CD200 cDNA clone (Cat# RC217941) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217941
• Predicted MW: 32.8 kDa
• Protein Sequence:
  Sequence Link

  >RC217941 representing NM_001004196
  Red=Cloning site Green=Tags(s)
  
  MERLTLTRTIGGPLLTATLLGKTTINDYQVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYT
  PASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLED
  EGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVT
  LSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISI
  LLYWKRHRNQDREP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001004196
• RefSeq Size: 2247
• RefSeq ORF: 882
• Synonyms: MOX1; MOX2; MRC; OX-2
• Locus ID: 4345
• UniProt ID: P41217
• Cytogenetics: 3q13.2
• Summary: 'This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]'
• Protein Families: Transmembrane