RBP2 (NM_004164) Human Mass Spec Standard

CAT#: PH317970

RBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004155)

Product Images

Coomassie blue staining of purified RBP2 protein (Cat# TP317970). The protein was produced from HEK293T cells transfected with RBP2 cDNA clone (Cat# RC217970) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217970
• Predicted MW: 15.5 kDa
• Protein Sequence:
  Sequence Link

  >RC217970 representing NM_004164
  Red=Cloning site Green=Tags(s)
  
  MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVE
  FDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004155
• RefSeq Size: 700
• RefSeq ORF: 402
• Synonyms: CRABP-II; CRBP2; CRBPII; RBPC2
• Locus ID: 5948
• UniProt ID: P50120
• Cytogenetics: 3q23
• Summary: 'This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq, Aug 2015]'