C14orf130 (UBR7) (NM_175748) Human Mass Spec Standard
CAT#: PH318298
UBR7 MS Standard C13 and N15-labeled recombinant protein (NP_786924)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218298 |
| Predicted MW | 47.8 kDa |
| Protein Sequence |
>RC218298 representing NM_175748
Red=Cloning site Green=Tags(s) MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEE PAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRP YPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAVTKISTEDDG LVRNIDGIGDQEVIKPENGEHQDSTLKEDVPEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNA ESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQA TDRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM QYYCS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_786924 |
| RefSeq Size | 1576 |
| RefSeq ORF | 1275 |
| Synonyms | C14orf130 |
| Locus ID | 55148 |
| UniProt ID | Q8N806 |
| Cytogenetics | 14q32.12 |
| Summary | This gene encodes a UBR box-containing protein that belongs to the E3 ubiquitin ligase family. The protein also contains a plant homeodomain (PHD) in the C-terminus. In mammals, the encoded protein recognizes N-degrons, the destabilizing N-terminal residues of short-lived proteins, which results in ubiquitinylation, and proteolysis via the proteasome. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403580 | UBR7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC413295 | C14orf130 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420256 | UBR7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426111 | UBR7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403580 | Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 2 |
USD 436.00 |
|
| LY413295 | Transient overexpression lysate of chromosome 14 open reading frame 130 (C14orf130), transcript variant 1 |
USD 436.00 |
|
| LY420256 | Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 3 |
USD 436.00 |
|
| LY426111 | Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 3 |
USD 396.00 |
|
| TP318298 | Recombinant protein of human ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China