DUSP13 (NM_001007272) Human Mass Spec Standard

CAT#: PH318322

DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_001007273)

Product Images

Coomassie blue staining of purified DUSP13 protein (Cat# TP318322). The protein was produced from HEK293T cells transfected with DUSP13 cDNA clone (Cat# RC218322) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218322
• Predicted MW: 27.3 kDa
• Protein Sequence:
  Sequence Link

  >RC218322 representing NM_001007272
  Red=Cloning site Green=Tags(s)
  
  MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAMDSLQKQDLRRPKIHGAVQA
  SPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAK
  FYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMT
  LVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007273
• RefSeq Size: 1063
• RefSeq ORF: 744
• Synonyms: BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
• Locus ID: 51207
• UniProt ID: Q6B8I1
• Cytogenetics: 10q22.2
• Summary: Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Phosphatase