DUSP13 (NM_016364) Human Recombinant Protein
CAT#: TP303085
Recombinant protein of human dual specificity phosphatase 13 (DUSP13), transcript variant 6
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203085 protein sequence
Red=Cloning site Green=Tags(s) MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQL GITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAM GVSRSATLVLAFLMIYENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057448 |
Locus ID | 51207 |
UniProt ID | Q9UII6 |
Cytogenetics | 10q22.2 |
Refseq Size | 923 |
Refseq ORF | 594 |
Synonyms | BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP |
Summary | Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413984 | DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423481 | DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423482 | DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413984 | Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 6 |
USD 396.00 |
|
LY423481 | Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 2 |
USD 396.00 |
|
LY423482 | Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 3 |
USD 396.00 |
|
PH303085 | DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_057448) |
USD 2,055.00 |
|
PH318322 | DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_001007273) |
USD 2,055.00 |
|
TP318322 | Recombinant protein of human dual specificity phosphatase 13 (DUSP13), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review