PROP1 (NM_006261) Human Mass Spec Standard

CAT#: PH318746

PROP1 MS Standard C13 and N15-labeled recombinant protein (NP_006252)

Product Images

Coomassie blue staining of purified PROP1 protein (Cat# TP318746). The protein was produced from HEK293T cells transfected with PROP1 cDNA clone (Cat# RC218746) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218746
• Predicted MW: 25 kDa
• Protein Sequence:
  Sequence Link

  >RC218746 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQGGQRGRPHSRR
  RHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSP
  AAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPP
  PPPMLPLSLEPSKSWN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006252
• RefSeq Size: 1464
• RefSeq ORF: 678
• Synonyms: CPHD2; PROP-1
• Locus ID: 5626
• UniProt ID: O75360, A0A0G2JQ02
• Cytogenetics: 5q35.3
• Summary: This gene encodes a paired-like homeodomain transcription factor in the developing pituitary gland. Expression occurs prior to and is required for expression of pou domain transcription factor 1, which is responsible for pituitary development and hormone expression. Mutations in this gene have been associated with combined pituitary hormone deficiency-2 as well as deficiencies in luteinizing hormone, follicle-stimulating hormone, growth hormone, prolactin, and thyroid-stimulating hormone. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome, Transcription Factors