STK19 (NM_004197) Human Mass Spec Standard

CAT#: PH318770

STK19 MS Standard C13 and N15-labeled recombinant protein (NP_004188)

Product Images

Coomassie blue staining of purified STK19 protein (Cat# TP318770). The protein was produced from HEK293T cells transfected with STK19 cDNA clone (Cat# RC218770) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218770
• Predicted MW: 40.3 kDa
• Protein Sequence:
  Sequence Link

  >RC218770 representing NM_004197
  Red=Cloning site Green=Tags(s)
  
  MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGG
  GDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLR
  GEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAH
  GIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRD
  AGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDC
  ISTTSGTLLRLPET
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004188
• RefSeq Size: 1620
• RefSeq ORF: 1092
• Synonyms: D6S60; D6S60E; G11; HLA-RP1; RP1
• Locus ID: 8859
• UniProt ID: P49842, A0A1U9X8L3
• Cytogenetics: 6p21.33
• Summary: This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase