PMP22 (NM_153322) Human Mass Spec Standard

CAT#: PH318781

PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_696997)

Product Images

Coomassie blue staining of purified PMP22 protein (Cat# TP318781). The protein was produced from HEK293T cells transfected with PMP22 cDNA clone (Cat# RC218781) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218781
• Predicted MW: 17.7 kDa
• Protein Sequence:
  Sequence Link

  >RC218781 representing NM_153322
  Red=Cloning site Green=Tags(s)
  
  MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMI
  LSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAW
  VAFPLALLSGVIYVILRKRE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_696997
• RefSeq Size: 1669
• RefSeq ORF: 480
• Synonyms: CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110
• Locus ID: 5376
• UniProt ID: Q01453, Q6FH25
• Cytogenetics: 17p12
• Summary: 'This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Studies suggest two alternately used promoters drive tissue-specific expression. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]'
• Protein Families: Transmembrane