HFE (NM_139006) Human Mass Spec Standard
CAT#: PH319316
HFE MS Standard C13 and N15-labeled recombinant protein (NP_620575)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219316 |
Predicted MW | 36.2 kDa |
Protein Sequence |
>RC219316 representing NM_139006
Red=Cloning site Green=Tags(s) MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVTTLR CRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLI VIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620575 |
RefSeq Size | 1045 |
RefSeq ORF | 1002 |
Synonyms | HFE1; HH; HLA-H; MVCD7; TFQTL2 |
Locus ID | 3077 |
UniProt ID | Q30201 |
Cytogenetics | 6p22.2 |
Summary | 'The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408433 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408436 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424725 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408433 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 6 |
USD 396.00 |
|
LY408436 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 9 |
USD 396.00 |
|
LY424725 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 1 |
USD 396.00 |
|
PH317447 | HFE MS Standard C13 and N15-labeled recombinant protein (NP_000401) |
USD 2,055.00 |
|
PH319465 | HFE MS Standard C13 and N15-labeled recombinant protein (NP_620578) |
USD 2,055.00 |
|
TP317447 | Recombinant protein of human hemochromatosis (HFE), transcript variant 1 |
USD 748.00 |
|
TP319316 | Purified recombinant protein of Homo sapiens hemochromatosis (HFE), transcript variant 6 |
USD 823.00 |
|
TP319465 | Purified recombinant protein of Homo sapiens hemochromatosis (HFE), transcript variant 9 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review