CD272 (BTLA) (NM_181780) Human Mass Spec Standard

CAT#: PH319458

BTLA MS Standard C13 and N15-labeled recombinant protein (NP_861445)

Product Images

Coomassie blue staining of purified BTLA protein (Cat# TP319458). The protein was produced from HEK293T cells transfected with BTLA cDNA clone (Cat# RC219458) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219458
• Predicted MW: 32.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219458 representing NM_181780
  Red=Cloning site Green=Tags(s)
  
  MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT
  WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS
  ERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA
  STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPT
  EYASICVRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_861445
• RefSeq Size: 1239
• RefSeq ORF: 867
• Synonyms: BTLA1; CD272
• Locus ID: 151888
• UniProt ID: Q7Z6A9
• Cytogenetics: 3q13.2
• Summary: This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011]
• Protein Families: Transmembrane