CD272 (BTLA) (NM_181780) Human Recombinant Protein

CAT#: TP319458

Recombinant protein of human B and T lymphocyte associated (BTLA), transcript variant 1

Product Images

Coomassie blue staining of purified BTLA protein (Cat# TP319458). The protein was produced from HEK293T cells transfected with BTLA cDNA clone (Cat# RC219458) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219458 representing NM_181780
  Red=Cloning site Green=Tags(s)
  
  MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT
  WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS
  ERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA
  STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPT
  EYASICVRS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_861445
• Locus ID: 151888
• UniProt ID: Q7Z6A9
• Cytogenetics: 3q13.2
• Refseq Size: 1239
• Refseq ORF: 867
• Synonyms: BTLA1; CD272
• Summary: This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011]
• Protein Families: Transmembrane