PLA1A (NM_015900) Human Mass Spec Standard

CAT#: PH319486

PLA1A MS Standard C13 and N15-labeled recombinant protein (NP_056984)

Product Images

Coomassie blue staining of purified PLA1A protein (Cat# TP319486). The protein was produced from HEK293T cells transfected with PLA1A cDNA clone (Cat# RC219486) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219486
• Predicted MW: 49.5 kDa
• Protein Sequence:
  Sequence Link

  >RC219486 representing NM_015900
  Red=Cloning site Green=Tags(s)
  
  MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGS
  SDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLS
  LEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRASVEERLDAGDA
  LFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAF
  PCASYKAFLAGRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKEL
  RNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC
  TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056984
• RefSeq Size: 1758
• RefSeq ORF: 1368
• Synonyms: PS-PLA1; PSPLA1
• Locus ID: 51365
• UniProt ID: Q53H76
• Cytogenetics: 3q13.33
• Summary: The protein encoded by this gene is a phospholipase that hydrolyzes fatty acids at the sn-1 position of phosphatidylserine and 1-acyl-2-lysophosphatidylserine. This secreted protein hydrolyzes phosphatidylserine in liposomes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]
• Protein Families: Druggable Genome, Secreted Protein