SAP155 (SF3B1) (NM_001005526) Human Mass Spec Standard

CAT#: PH319649

SF3B1 MS Standard C13 and N15-labeled recombinant protein (NP_001005526)

Product Images

Coomassie blue staining of purified SF3B1 protein (Cat# TP319649). The protein was produced from HEK293T cells transfected with SF3B1 cDNA clone (Cat# RC219649) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219649
• Predicted MW: 15.8 kDa
• Protein Sequence:
  Sequence Link

  >RC219649 representing NM_001005526
  Red=Cloning site Green=Tags(s)
  
  MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDY
  SSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGF
  YSAA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001005526
• RefSeq Size: 647
• RefSeq ORF: 432
• Synonyms: Hsh155; MDS; PRP10; PRPF10; SAP155; SF3b155
• Locus ID: 23451
• UniProt ID: B4DGZ4
• Cytogenetics: 2q33.1
• Summary: This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Pathways: Spliceosome