SAP155 (SF3B1) (NM_001005526) Human Recombinant Protein

CAT#: TP319649

Recombinant protein of human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2

Product Images

Coomassie blue staining of purified SF3B1 protein (Cat# TP319649). The protein was produced from HEK293T cells transfected with SF3B1 cDNA clone (Cat# RC219649) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219649 representing NM_001005526
  Red=Cloning site Green=Tags(s)
  
  MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDY
  SSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGF
  YSAA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001005526
• Locus ID: 23451
• UniProt ID: B4DGZ4
• Cytogenetics: 2q33.1
• Refseq Size: 647
• Refseq ORF: 432
• Synonyms: Hsh155; MDS; PRP10; PRPF10; SAP155; SF3b155
• Summary: This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Pathways: Spliceosome