Germany
Japan
United Kingdom
China
SAP155 (SF3B1) Rabbit Polyclonal Antibody
Product Images
USD 823.00
USD 325.00
USD 159.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the middle region of human SF3B1. Synthetic peptide located within the following region: LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 87 kDa |
| Gene Name | splicing factor 3b subunit 1 |
| Database Link | |
| Background | SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. |
| Synonyms | Hsh155; MDS; PRP10; PRPF10; SAP155; SF3b155 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 86%; Zebrafish: 86% |
| Reference Data | |
| Protein Pathways | Spliceosome |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
Be the first one to submit a review
