Sterol carrier protein 2 (SCP2) (NM_002979) Human Mass Spec Standard
CAT#: PH319802
SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_002970)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219802 |
Predicted MW | 58.8 kDa |
Protein Sequence |
>RC219802 representing NM_002979
Red=Cloning site Green=Tags(s) MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDST CGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPT DKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVM ASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDM SKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGL ISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSD KKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002970 |
RefSeq Size | 2697 |
RefSeq ORF | 1641 |
Synonyms | NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX |
Locus ID | 6342 |
UniProt ID | P22307, A0A384NY87, B2R761, Q59HG9 |
Cytogenetics | 1p32.3 |
Summary | 'This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010]' |
Protein Pathways | Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401042 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422797 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422798 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC434253 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC434278 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC434294 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401042 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 1 |
USD 605.00 |
|
LY422797 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 3 |
USD 396.00 |
|
LY422798 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 4 |
USD 396.00 |
|
LY434253 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 8 |
USD 396.00 |
|
LY434278 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 6 |
USD 396.00 |
|
LY434294 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 7 |
USD 396.00 |
|
PH318251 | SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_001007101) |
USD 2,055.00 |
|
TP318251 | Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 4 |
USD 867.00 |
|
TP319802 | Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review