DYNLL1 (NM_001037494) Human Mass Spec Standard
CAT#: PH319822
DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032583)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219822 |
Predicted MW | 10.2 kDa |
Protein Sequence |
>RC219822 representing NM_001037494
Red=Cloning site Green=Tags(s) MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET KHFIYFYLGQVAILLFKSG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001032583 |
RefSeq Size | 820 |
RefSeq ORF | 267 |
Synonyms | DLC1; DLC8; DNCL1; DNCLC1; hdlc1; LC8; LC8a; PIN |
Locus ID | 8655 |
UniProt ID | P63167, Q6FGH9 |
Cytogenetics | 12q24.31 |
Summary | Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418456 | DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421911 | DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421912 | DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425618 | DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418456 | Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3 |
USD 396.00 |
|
LY421911 | Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 |
USD 396.00 |
|
LY421912 | Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2 |
USD 396.00 |
|
LY425618 | Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2 |
USD 396.00 |
|
PH318700 | DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032584) |
USD 2,055.00 |
|
PH318752 | DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_003737) |
USD 2,055.00 |
|
TP318700 | Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2 |
USD 748.00 |
|
TP318752 | Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3 |
USD 748.00 |
|
TP319822 | Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 |
USD 748.00 |
|
TP720193 | Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review