LASP1 (NM_006148) Human Mass Spec Standard

CAT#: PH319975

LASP1 MS Standard C13 and N15-labeled recombinant protein (NP_006139)

Product Images

Coomassie blue staining of purified LASP1 protein (Cat# TP319975). The protein was produced from HEK293T cells transfected with LASP1 cDNA clone (Cat# RC219975) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219975
• Predicted MW: 29.5 kDa
• Protein Sequence:
  Sequence Link

  >RC219975 representing NM_006148
  Red=Cloning site Green=Tags(s)
  
  MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE
  NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME
  PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV
  YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006139
• RefSeq Size: 3846
• RefSeq ORF: 783
• Synonyms: Lasp-1; MLN50
• Locus ID: 3927
• UniProt ID: Q14847, A0A024R1S8
• Cytogenetics: 17q12
• Summary: This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. [provided by RefSeq, Oct 2012]
• Protein Families: Druggable Genome