TMIE (NM_147196) Human Mass Spec Standard

CAT#: PH320050

TMIE MS Standard C13 and N15-labeled recombinant protein (NP_671729)

Product Images

Coomassie blue staining of purified TMIE protein (Cat# TP320050). The protein was produced from HEK293T cells transfected with TMIE cDNA clone (Cat# RC220050) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220050
• Predicted MW: 17.1 kDa
• Protein Sequence:
  Sequence Link

  >RC220050 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSI
  IITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV
  EEDEKNEAKKKKGEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_671729
• RefSeq Size: 1861
• RefSeq ORF: 1424
• Synonyms: DFNB6
• Locus ID: 259236
• UniProt ID: Q8NEW7
• Cytogenetics: 3p21.31
• Summary: This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. [provided by RefSeq, Mar 2009]
• Protein Families: Transmembrane