TMIE (NM_147196) Human Recombinant Protein

CAT#: TP320050

Recombinant protein of human transmembrane inner ear (TMIE)

Product Images

Coomassie blue staining of purified TMIE protein (Cat# TP320050). The protein was produced from HEK293T cells transfected with TMIE cDNA clone (Cat# RC220050) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220050 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSI
  IITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV
  EEDEKNEAKKKKGEK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_671729
• Locus ID: 259236
• UniProt ID: Q8NEW7
• Cytogenetics: 3p21.31
• Refseq Size: 1861
• Refseq ORF: 465
• Synonyms: DFNB6
• Summary: This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. [provided by RefSeq, Mar 2009]
• Protein Families: Transmembrane