Galectin 8 (LGALS8) (NM_006499) Human Mass Spec Standard

CAT#: PH320102

LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_006490)

Product Images

Coomassie blue staining of purified LGALS8 protein (Cat# TP320102). The protein was produced from HEK293T cells transfected with LGALS8 cDNA clone (Cat# RC220102) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220102
• Predicted MW: 40.2 kDa
• Protein Sequence:
  Sequence Link

  >RC220102 representing NM_006499
  Red=Cloning site Green=Tags(s)
  
  MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRF
  KRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGI
  YGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLPSNRGGDISKIAPRTVYTKSKDSTVNH
  TLTCTKIPPMNYVSKRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKA
  FVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
  IHLLEVRSW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006490
• RefSeq Size: 2996
• RefSeq ORF: 1077
• Synonyms: Gal-8; PCTA-1; PCTA1; Po66-CBP
• Locus ID: 3964
• UniProt ID: O00214
• Cytogenetics: 1q43
• Summary: 'This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]'