Calcipressin 1 (RCAN1) (NM_004414) Human Mass Spec Standard

CAT#: PH320434

RCAN1 MS Standard C13 and N15-labeled recombinant protein (NP_004405)

Product Images

Coomassie blue staining of purified RCAN1 protein (Cat# TP320434). The protein was produced from HEK293T cells transfected with RCAN1 cDNA clone (Cat# RC220434) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220434
• Predicted MW: 27.9 kDa
• Protein Sequence:
  Sequence Link

  >RC220434 representing NM_004414
  Red=Cloning site Green=Tags(s)
  
  MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA
  CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF
  AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS
  VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004405
• RefSeq Size: 2457
• RefSeq ORF: 756
• Synonyms: ADAPT78; CSP1; DSC1; DSCR1; MCIP1; RCN1
• Locus ID: 1827
• UniProt ID: P53805
• Cytogenetics: 21q22.12
• Summary: 'The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]'
• Protein Families: Transcription Factors