CTPS2 (NM_175859) Human Mass Spec Standard
CAT#: PH320566
CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_787055)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220566 |
Predicted MW | 65.7 kDa |
Protein Sequence |
>RC220566 protein sequence
Red=Cloning site Green=Tags(s) MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLD LGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEP QICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLS PDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASN LLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETED PVKFHEAWQKLCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDAD STEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIK QFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCK LSSSDRYSDASDDSFSEPRIAELEIS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_787055 |
RefSeq Size | 3973 |
RefSeq ORF | 1758 |
Synonyms | DKFZp686C17207; FLJ43358; MGC32997 |
Locus ID | 56474 |
UniProt ID | Q9NRF8, A0A024RC00 |
Cytogenetics | Xp22.2 |
Summary | The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA. Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein. Thus, this protein is an attractive target for selective chemotherapy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406236 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC412688 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428462 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429600 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406236 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 2 |
USD 325.00 |
|
LY412688 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 1 |
USD 325.00 |
|
LY428462 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 3 |
USD 325.00 |
|
LY429600 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 1 |
USD 325.00 |
|
PH305993 | CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_062831) |
USD 2,055.00 |
|
PH326565 | CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137474) |
USD 2,055.00 |
|
TP305993 | Recombinant protein of human CTP synthase II (CTPS2), transcript variant 1 |
USD 823.00 |
|
TP320566 | Recombinant protein of human CTP synthase II (CTPS2), transcript variant 2 |
USD 748.00 |
|
TP326565 | Recombinant protein of human CTP synthase II (CTPS2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review