PHYHIP (NM_001099335) Human Mass Spec Standard

CAT#: PH320713

PHYHIP MS Standard C13 and N15-labeled recombinant protein (NP_001092805)

Product Images

Coomassie blue staining of purified PHYHIP protein (Cat# TP320713). The protein was produced from HEK293T cells transfected with PHYHIP cDNA clone (Cat# RC220713) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220713
• Predicted MW: 37.6 kDa
• Protein Sequence:
  Sequence Link

  >RC220713 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELLSTPHSIEINNITCDSFSISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPM
  TVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVF
  YRNHHKEYFEHARTHCGNMLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPA
  QRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSMGDRFCRDRRPLLDIACNKFLTCSVEDGELVFRHAQ
  DLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001092805
• RefSeq Size: 3354
• RefSeq ORF: 990
• Synonyms: DYRK1AP3; PAHX-AP; PAHXAP1
• Locus ID: 9796
• UniProt ID: Q92561
• Cytogenetics: 8p21.3
• Summary: Its interaction with PHYH suggests a role in the development of the central system. [UniProtKB/Swiss-Prot Function]