ZIC2 (NM_007129) Human Mass Spec Standard
CAT#: PH320798
ZIC2 MS Standard C13 and N15-labeled recombinant protein (NP_009060)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220798 |
Predicted MW | 54.8 kDa |
Protein Sequence |
>RC220798 representing NM_007129
Red=Cloning site Green=Tags(s) MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAFKLNPGAHELS PGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFLFRSRGFGDSAPGGGQHGLFG PGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQL HNQYGPMNMNMGMNMAAAAAHHHHHHHHHPGAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTM HELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENL KIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGSGSGGAGGGSG GGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009060 |
RefSeq Size | 2698 |
RefSeq ORF | 1596 |
Synonyms | HPE5 |
Locus ID | 7546 |
UniProt ID | O95409, A0A024RDY6 |
Cytogenetics | 13q32.3 |
Summary | This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This protein functions as a transcriptional repressor and may regulate tissue specific expression of dopamine receptor D1. Expansion of an alanine repeat in the C-terminus of the encoded protein and other mutations in this gene cause holoprosencephaly type 5. Holoprosencephaly is the most common structural anomaly of the human brain. A polyhistidine tract polymorphism in this gene may be associated with increased risk of neural tube defects. This gene is closely linked to a gene encoding zinc finger protein of the cerebellum 5, a related family member on chromosome 13. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Hedgehog signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416175 | ZIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY416175 | Transient overexpression lysate of Zic family member 2 (odd-paired homolog, Drosophila) (ZIC2) |
USD 605.00 |
|
TP320798 | Recombinant protein of human Zic family member 2 (odd-paired homolog, Drosophila) (ZIC2) |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review