CNN2 (NM_004368) Human Mass Spec Standard
CAT#: PH321104
CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_004359)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221104 |
Predicted MW | 33.5 kDa |
Protein Sequence |
>RC221104 representing NM_004368
Red=Cloning site Green=Tags(s) MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA DGAPSGTGDCPDPGEVPEYPPYYQEEAGY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004359 |
RefSeq Size | 2478 |
RefSeq ORF | 927 |
Synonyms | calponin 2; calponin H2, smooth muscle; neutral calponin |
Locus ID | 1265 |
UniProt ID | Q99439 |
Cytogenetics | 19p13.3 |
Summary | 'The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404509 | CNN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC418024 | CNN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404509 | Transient overexpression lysate of calponin 2 (CNN2), transcript variant 2 |
USD 325.00 |
|
LY418024 | Transient overexpression lysate of calponin 2 (CNN2), transcript variant 1 |
USD 325.00 |
|
PH312208 | CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_958434) |
USD 2,055.00 |
|
TP312208 | Purified recombinant protein of Homo sapiens calponin 2 (CNN2), transcript variant 2 |
USD 748.00 |
|
TP321104 | Recombinant protein of human calponin 2 (CNN2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review