ZDHHC15 (NM_144969) Human Mass Spec Standard

CAT#: PH321105

ZDHHC15 MS Standard C13 and N15-labeled recombinant protein (NP_659406)

Product Images

Coomassie blue staining of purified ZDHHC15 protein (Cat# TP321105). The protein was produced from HEK293T cells transfected with ZDHHC15 cDNA clone (Cat# RC221105) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221105
• Predicted MW: 39.2 kDa
• Protein Sequence:
  Sequence Link

  >RC221105 representing NM_144969
  Red=Cloning site Green=Tags(s)
  
  MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTW
  TYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPD
  RCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSK
  FHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKF
  WLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_659406
• RefSeq Size: 1782
• RefSeq ORF: 1011
• Synonyms: DHHC15; MRX91
• Locus ID: 158866
• UniProt ID: Q96MV8, B3KY34
• Cytogenetics: Xq13.3
• Summary: The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
• Protein Families: Transmembrane