ZDHHC15 (NM_144969) Human Recombinant Protein

CAT#: TP321105

Recombinant protein of human zinc finger, DHHC-type containing 15 (ZDHHC15)

Product Images

Coomassie blue staining of purified ZDHHC15 protein (Cat# TP321105). The protein was produced from HEK293T cells transfected with ZDHHC15 cDNA clone (Cat# RC221105) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221105 representing NM_144969
  Red=Cloning site Green=Tags(s)
  
  MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTW
  TYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPD
  RCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSK
  FHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKF
  WLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_659406
• Locus ID: 158866
• UniProt ID: Q96MV8, B3KY34
• Cytogenetics: Xq13.3
• Refseq Size: 1782
• Refseq ORF: 1011
• Synonyms: DHHC15; MRX91
• Summary: The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
• Protein Families: Transmembrane