Caveolin 3 (CAV3) (NM_033337) Human Mass Spec Standard

CAT#: PH321140

CAV3 MS Standard C13 and N15-labeled recombinant protein (NP_203123)

Product Images

Coomassie blue staining of purified CAV3 protein (Cat# TP321140). The protein was produced from HEK293T cells transfected with CAV3 cDNA clone (Cat# RC221140) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221140
• Predicted MW: 17.3 kDa
• Protein Sequence:
  Sequence Link

  >RC221140 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKY
  WCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVC
  SSIKVVLRKEV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_203123
• RefSeq Size: 1435
• RefSeq ORF: 453
• Synonyms: LGMD1C; LQT9; MPDT; RMD2; VIP-21; VIP21
• Locus ID: 859
• UniProt ID: P56539
• Cytogenetics: 3p25.3
• Summary: 'This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Focal adhesion