Protein Kinase D2 (PRKD2) (NM_001079881) Human Mass Spec Standard
CAT#: PH321498
PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073350)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221498 |
Predicted MW | 96.5 kDa |
Protein Sequence |
>RC221498 representing NM_001079881
Red=Cloning site Green=Tags(s) MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001073350 |
RefSeq Size | 3202 |
RefSeq ORF | 2634 |
Synonyms | HSPC187; nPKC-D2; PKD2 |
Locus ID | 25865 |
UniProt ID | Q9BZL6 |
Cytogenetics | 19q13.32 |
Summary | The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It can bind to diacylglycerol (DAG) in the trans-Golgi network (TGN) and may regulate basolateral membrane protein exit from TGN. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402555 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421574 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421575 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425905 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425906 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY402555 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 1 |
USD 605.00 |
|
LY421574 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 2 |
USD 605.00 |
|
LY421575 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 3 |
USD 605.00 |
|
LY425905 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 2 |
USD 605.00 |
|
LY425906 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 3 |
USD 605.00 |
|
PH315335 | PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_057541) |
USD 2,055.00 |
|
PH321442 | PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073349) |
USD 2,055.00 |
|
TP315335 | Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 1 |
USD 867.00 |
|
TP321442 | Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 2 |
USD 748.00 |
|
TP321498 | Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review