Protein Kinase D2 (PRKD2) (NM_016457) Human Recombinant Protein
CAT#: TP315335
Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 1
USD 379.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215335 representing NM_016457
Red=Cloning site Green=Tags(s) MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 96.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057541 |
Locus ID | 25865 |
UniProt ID | Q9BZL6 |
Cytogenetics | 19q13.32 |
Refseq Size | 2883 |
Refseq ORF | 2634 |
Synonyms | HSPC187; nPKC-D2; PKD2 |
Summary | The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It can bind to diacylglycerol (DAG) in the trans-Golgi network (TGN) and may regulate basolateral membrane protein exit from TGN. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402555 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421574 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421575 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425905 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425906 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY402555 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 1 |
USD 605.00 |
|
LY421574 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 2 |
USD 605.00 |
|
LY421575 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 3 |
USD 605.00 |
|
LY425905 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 2 |
USD 605.00 |
|
LY425906 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 3 |
USD 605.00 |
|
PH315335 | PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_057541) |
USD 2,055.00 |
|
PH321442 | PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073349) |
USD 2,055.00 |
|
PH321498 | PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073350) |
USD 2,055.00 |
|
TP321442 | Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 2 |
USD 748.00 |
|
TP321498 | Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review