PANK1 (NM_148977) Human Mass Spec Standard
CAT#: PH321538
PANK1 MS Standard C13 and N15-labeled recombinant protein (NP_683878)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221538 |
Predicted MW | 64.2 kDa |
Protein Sequence |
>RC221538 representing NM_148977
Red=Cloning site Green=Tags(s) MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAGVLQAGAVGPA RGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDLQRGRLSRGPRTAPPAPGMGD RSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPPHVCSRGPVGGSDAAPQRLPLLPELQPQPLL PQHDSPAKKCRLRRRMDSGRKNRPPFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSN TAYGKTGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDF RMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQG SAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLA YAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_683878 |
RefSeq Size | 3367 |
RefSeq ORF | 1794 |
Synonyms | PANK |
Locus ID | 53354 |
UniProt ID | Q8TE04 |
Cytogenetics | 10q23.31 |
Summary | This gene encodes a member of the pantothenate kinase family. Pantothenate kinases are key regulatory enzymes in the biosynthesis of coenzyme A (CoA). The encoded protein catalyzes the first and rate-limiting enzymatic reaction in CoA biosynthesis and is regulated by CoA through feedback inhibition. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. This gene and an intronic miRNA on the same strand are co-regulated by the tumor suppressor p53 (see PMID 20833636). [provided by RefSeq, Apr 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407715 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC407716 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408718 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407715 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant alpha |
USD 605.00 |
|
LY407716 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant beta |
USD 396.00 |
|
LY408718 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant gamma |
USD 396.00 |
|
PH321519 | PANK1 MS Standard C13 and N15-labeled recombinant protein (NP_612189) |
USD 2,055.00 |
|
TP321519 | Recombinant protein of human pantothenate kinase 1 (PANK1), transcript variant gamma |
USD 788.00 |
|
TP321538 | Recombinant protein of human pantothenate kinase 1 (PANK1), transcript variant alpha |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review