Midkine (MDK) (NM_001012334) Human Mass Spec Standard

CAT#: PH321818

MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012334)

Product Images

Coomassie blue staining of purified MDK protein (Cat# TP321818). The protein was produced from HEK293T cells transfected with MDK cDNA clone (Cat# RC221818) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221818
• Predicted MW: 15.6 kDa
• Protein Sequence:
  Sequence Link

  >RC221818 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC
  RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK
  GKD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001012334
• RefSeq Size: 1015
• RefSeq ORF: 429
• Synonyms: ARAP; MK; NEGF2
• Locus ID: 4192
• UniProt ID: P21741
• Cytogenetics: 11p11.2
• Summary: 'This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane