Midkine (MDK) (NM_001012333) Human Recombinant Protein
CAT#: TP303995
Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203995 protein sequence
Red=Cloning site Green=Tags(s) MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK GKD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001012333 |
Locus ID | 4192 |
UniProt ID | P21741 |
Cytogenetics | 11p11.2 |
Refseq Size | 969 |
Refseq ORF | 429 |
Synonyms | ARAP; MK; NEGF2 |
Summary | This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419358 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423327 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423328 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425316 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419358 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3 |
USD 396.00 |
|
LY423327 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2 |
USD 396.00 |
|
LY423328 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 |
USD 396.00 |
|
LY425316 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 |
USD 396.00 |
|
PH303995 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012333) |
USD 2,055.00 |
|
PH313133 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_002382) |
USD 2,055.00 |
|
PH321818 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012334) |
USD 2,055.00 |
|
TP313133 | Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3 |
USD 748.00 |
|
TP321818 | Purified recombinant protein of Homo sapiens midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 |
USD 748.00 |
|
TP723298 | Purified recombinant protein of Human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review