DPPA5 (NM_001025290) Human Mass Spec Standard

CAT#: PH322509

DPPA5 MS Standard C13 and N15-labeled recombinant protein (NP_001020461)

Product Images

Coomassie blue staining of purified DPPA5 protein (Cat# TP322509). The protein was produced from HEK293T cells transfected with DPPA5 cDNA clone (Cat# RC222509) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222509
• Predicted MW: 13.3 kDa
• Protein Sequence:
  Sequence Link

  >RC222509 representing NM_001025290
  Red=Cloning site Green=Tags(s)
  
  MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV
  YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001020461
• RefSeq Size: 612
• RefSeq ORF: 348
• Synonyms: ESG1
• Locus ID: 340168
• UniProt ID: A6NC42
• Cytogenetics: 6q13
• Summary: This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010]