MSMP (NM_001044264) Human Mass Spec Standard

CAT#: PH322527

MSMP MS Standard C13 and N15-labeled recombinant protein (NP_001037729)

Product Images

Coomassie blue staining of purified MSMP protein (Cat# TP322527). The protein was produced from HEK293T cells transfected with MSMP cDNA clone (Cat# RC222527) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222527
• Predicted MW: 14.99 kDa
• Protein Sequence:
  Sequence Link

  >RC222527 representing NM_001044264
  Red=Cloning site Green=Tags(s)
  
  MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL
  HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001037729
• RefSeq Size: 672
• RefSeq ORF: 417
• Synonyms: PSMP
• Locus ID: 692094
• UniProt ID: Q1L6U9
• Cytogenetics: 9p13.3
• Summary: This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [provided by RefSeq, Jan 2011]
• Protein Families: Transmembrane