MSMP (NM_001044264) Human Mass Spec Standard
CAT#: PH322527
MSMP MS Standard C13 and N15-labeled recombinant protein (NP_001037729)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222527 |
Predicted MW | 14.99 kDa |
Protein Sequence |
>RC222527 representing NM_001044264
Red=Cloning site Green=Tags(s) MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001037729 |
RefSeq Size | 672 |
RefSeq ORF | 417 |
Synonyms | PSMP |
Locus ID | 692094 |
UniProt ID | Q1L6U9 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [provided by RefSeq, Jan 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420820 | MSMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY420820 | Transient overexpression lysate of microseminoprotein, prostate associated (MSMP) |
USD 396.00 |
|
TP322527 | Recombinant protein of human microseminoprotein, prostate associated (MSMP) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review