MSMP (NM_001044264) Human Recombinant Protein
CAT#: TP322527
Recombinant protein of human microseminoprotein, prostate associated (MSMP)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222527 representing NM_001044264
Red=Cloning site Green=Tags(s) MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | Cell treatment (PMID: 29059175) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001037729 |
Locus ID | 692094 |
UniProt ID | Q1L6U9 |
Cytogenetics | 9p13.3 |
Refseq Size | 672 |
Refseq ORF | 417 |
Synonyms | PSMP |
Summary | This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [provided by RefSeq, Jan 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420820 | MSMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY420820 | Transient overexpression lysate of microseminoprotein, prostate associated (MSMP) |
USD 396.00 |
|
PH322527 | MSMP MS Standard C13 and N15-labeled recombinant protein (NP_001037729) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review