MSMP (NM_001044264) Human Recombinant Protein

CAT#: TP322527

Recombinant protein of human microseminoprotein, prostate associated (MSMP)

Product Images

Coomassie blue staining of purified MSMP protein (Cat# TP322527). The protein was produced from HEK293T cells transfected with MSMP cDNA clone (Cat# RC222527) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222527 representing NM_001044264
  Red=Cloning site Green=Tags(s)
  
  MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL
  HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Cell treatment (PMID: 29059175)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001037729
• Locus ID: 692094
• UniProt ID: Q1L6U9
• Cytogenetics: 9p13.3
• Refseq Size: 672
• Refseq ORF: 417
• Synonyms: PSMP
• Summary: This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [provided by RefSeq, Jan 2011]
• Protein Families: Transmembrane