SEC13L1 (SEC13) (NM_183352) Human Mass Spec Standard

CAT#: PH322811

SEC13 MS Standard C13 and N15-labeled recombinant protein (NP_899195)

Product Images

Coomassie blue staining of purified SEC13 protein (Cat# TP322811). The protein was produced from HEK293T cells transfected with SEC13 cDNA clone (Cat# RC222811) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222811
• Predicted MW: 35.5 kDa
• Protein Sequence:
  Sequence Link

  >RC222811 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY
  GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW
  EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA
  HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS
  GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_899195
• RefSeq Size: 1437
• RefSeq ORF: 966
• Synonyms: D3S1231E; npp-20; SEC13L1; SEC13R
• Locus ID: 6396
• UniProt ID: P55735
• Cytogenetics: 3p25.3
• Summary: 'The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008]'