SEC13L1 (SEC13) (NM_183352) Human Recombinant Protein

CAT#: TP322811

Recombinant protein of human SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1

Product Images

Coomassie blue staining of purified SEC13 protein (Cat# TP322811). The protein was produced from HEK293T cells transfected with SEC13 cDNA clone (Cat# RC222811) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222811 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY
  GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW
  EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA
  HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS
  GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_899195
• Locus ID: 6396
• UniProt ID: P55735
• Cytogenetics: 3p25.3
• Refseq Size: 1437
• Refseq ORF: 966
• Synonyms: D3S1231E; npp-20; SEC13L1; SEC13R
• Summary: The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008]