Sprouty 1 (SPRY1) (NM_199327) Human Mass Spec Standard

CAT#: PH322860

SPRY1 MS Standard C13 and N15-labeled recombinant protein (NP_955359)

Product Images

Coomassie blue staining of purified SPRY1 protein (Cat# TP322860). The protein was produced from HEK293T cells transfected with SPRY1 cDNA clone (Cat# RC222860) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222860
• Predicted MW: 35.1 kDa
• Protein Sequence:
  Sequence Link

  >RC222860 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR
  QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSP
  PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLC
  SAESMVEYGTCMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCL
  KLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_955359
• RefSeq Size: 2380
• RefSeq ORF: 957
• Synonyms: hSPRY1
• Locus ID: 10252
• UniProt ID: O43609
• Cytogenetics: 4q28.1
• Summary: May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Jak-STAT signaling pathway