Sprouty 1 (SPRY1) (NM_199327) Human Recombinant Protein

CAT#: TP322860

Purified recombinant protein of Homo sapiens sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 2

Product Images

Coomassie blue staining of purified SPRY1 protein (Cat# TP322860). The protein was produced from HEK293T cells transfected with SPRY1 cDNA clone (Cat# RC222860) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222860 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR
  QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSP
  PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLC
  SAESMVEYGTCMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCL
  KLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_955359
• Locus ID: 10252
• UniProt ID: O43609
• Cytogenetics: 4q28.1
• Refseq Size: 2380
• Refseq ORF: 957
• Synonyms: hSPRY1
• Summary: May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Jak-STAT signaling pathway