UNG (NM_080911) Human Mass Spec Standard

CAT#: PH322868

UNG MS Standard C13 and N15-labeled recombinant protein (NP_550433)

Product Images

Coomassie blue staining of purified UNG protein (Cat# TP322868). The protein was produced from HEK293T cells transfected with UNG cDNA clone (Cat# RC222868) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222868
• Predicted MW: 34.5 kDa
• Protein Sequence:
  Sequence Link

  >RC222868 representing NM_080911
  Red=Cloning site Green=Tags(s)
  
  MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ
  LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM
  CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL
  LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP
  LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_550433
• RefSeq Size: 2053
• RefSeq ORF: 939
• Synonyms: DGU; HIGM4; HIGM5; UDG; UNG1; UNG2; UNG15
• Locus ID: 7374
• UniProt ID: P13051, E5KTA5
• Cytogenetics: 12q24.11
• Summary: 'This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Base excision repair, Primary immunodeficiency