HOPX (NM_139212) Human Mass Spec Standard
CAT#: PH322903
HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631958)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222903 |
Predicted MW | 8.1 kDa |
Protein Sequence |
>RC222903 representing NM_139212
Red=Cloning site Green=Tags(s) MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS VTD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_631958 |
RefSeq Size | 1116 |
RefSeq ORF | 219 |
Synonyms | CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO |
Locus ID | 84525 |
UniProt ID | Q9BPY8 |
Cytogenetics | 4q12 |
Summary | The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408356 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408357 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC410073 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428902 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430097 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430098 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408356 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 2 |
USD 396.00 |
|
LY408357 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 3 |
USD 396.00 |
|
LY410073 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 1 |
USD 396.00 |
|
LY428902 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 4 |
USD 396.00 |
|
LY430097 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 2 |
USD 396.00 |
|
LY430098 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 3 |
USD 396.00 |
|
PH304361 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631957) |
USD 2,055.00 |
|
PH322859 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_115884) |
USD 2,055.00 |
|
TP304361 | Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 2 |
USD 823.00 |
|
TP322859 | Recombinant protein of human HOP homeobox (HOPX), transcript variant 1 |
USD 748.00 |
|
TP322903 | Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review